Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnaja1 Peptide - N-terminal region

Dnaja1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hsj2, Nedd7

UniProt

P63037

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnaja1 Rabbit Polyclonal Antibody (orb582392) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032324

Preservative

Lyophilized powder

AA Sequence

YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coxsackie Virus B5 (Biotin) discontinued
C7904-91G-Biotin 100 µL

Coxsackie Virus B5 (Biotin) discontinued

Sign In for Pricing
View Details
AP2M1 Mouse Monoclonal Antibody [Clone ID: OTI1C8]
TA503018S 30 µL

AP2M1 Mouse Monoclonal Antibody [Clone ID: OTI1C8]

Sign In for Pricing
View Details
InVivoMAb Anti-Mouse CD279/PDCD1/PD1 Antibody (RMP1-14)
VMH02202-01 100 µg

InVivoMAb Anti-Mouse CD279/PDCD1/PD1 Antibody (RMP1-14)

Sign In for Pricing
View Details
InVivoMAb Anti-Mouse CD279/PDCD1/PD1 Antibody (RMP1-14)
VMH02202-02 1 mg

InVivoMAb Anti-Mouse CD279/PDCD1/PD1 Antibody (RMP1-14)

Sign In for Pricing
View Details
ALDH1A3 Antibody, HRP conjugated
CSB-PA001567LB01HU-01 50 µg

ALDH1A3 Antibody, HRP conjugated

Sign In for Pricing
View Details
ALDH1A3 Antibody, HRP conjugated
CSB-PA001567LB01HU-02 100 µg

ALDH1A3 Antibody, HRP conjugated

Sign In for Pricing
View Details