Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajb1 Peptide - C-terminal region

Dnajb1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

0610007I11Rik, HSPF1, Hsp40

UniProt

Q9QYJ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajb1 Rabbit Polyclonal Antibody (orb582486) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061278

Preservative

Lyophilized powder

AA Sequence

VFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLVIEFEVIFPERIPVSSRTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cervix
CS801298 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
CREG1 Human Gene Knockout Kit (CRISPR)
KN401654 1 Kit

CREG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Bromophenetole
TRC-B686150-250G 250 g

4-Bromophenetole

Sign In for Pricing
View Details
Mouse Ccr2 activation kit by CRISPRa
GA200774 1 Kit

Mouse Ccr2 activation kit by CRISPRa

Sign In for Pricing
View Details
TRITC Conjugated Rabbit Affinity Purified Antibody to Goat IgG, Fc Specific
RAF-521-1 1 mL

TRITC Conjugated Rabbit Affinity Purified Antibody to Goat IgG, Fc Specific

Sign In for Pricing
View Details
Recombinant Human COL8A1 Protein (His Tag)
PKSH032267-01 10 µg

Recombinant Human COL8A1 Protein (His Tag)

Sign In for Pricing
View Details