Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajb1 Peptide - C-terminal region

Dnajb1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

0610007I11Rik, HSPF1, Hsp40

UniProt

Q9QYJ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajb1 Rabbit Polyclonal Antibody (orb582486) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061278

Preservative

Lyophilized powder

AA Sequence

VFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLVIEFEVIFPERIPVSSRTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DMRT2 activation kit by CRISPRa
GA107303 1 Kit

Human DMRT2 activation kit by CRISPRa

Sign In for Pricing
View Details
CMV-p65 (CMV100), CF594 conjugate, 0.1mg/mL
BNC940100-500 1x 500 µL

CMV-p65 (CMV100), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
INSL4 Antibody
8C15598-AAT 50 µg

INSL4 Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD94 Antibody[DX22]
E-AB-F1384C-01 20 Tests

FITC Anti-Human CD94 Antibody[DX22]

Sign In for Pricing
View Details
FITC Anti-Human CD94 Antibody[DX22]
E-AB-F1384C-02 100 Tests

FITC Anti-Human CD94 Antibody[DX22]

Sign In for Pricing
View Details
FITC Anti-Human CD94 Antibody[DX22]
E-AB-F1384C-03 2x 100 Tests

FITC Anti-Human CD94 Antibody[DX22]

Sign In for Pricing
View Details