Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajb12 Peptide - N-terminal region

Dnajb12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Dj10, mDj10

UniProt

Q8K037

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajb12 Rabbit Polyclonal Antibody (orb576265) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064349

Preservative

Lyophilized powder

AA Sequence

NQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®503R Succinimidyl Ester
#96078 1x 1 µmol

CF®503R Succinimidyl Ester

Sign In for Pricing
View Details
3-Hydroxyindole
TRC-H943505-250MG 250 mg

3-Hydroxyindole

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), CF647 conjugate, 0.1mg/mL
BNC472419-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PPIC activation kit by CRISPRa
GA103697 1 Kit

Human PPIC activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Small intestine
CR562852 5 µg

Tissue Total RNA, Small intestine

Sign In for Pricing
View Details
Vmn1r113 Mouse Gene Knockout Kit (CRISPR)
KN518914 1 Kit

Vmn1r113 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details