Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajb12 Peptide - N-terminal region

Dnajb12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Dj10, mDj10

UniProt

Q8K037

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajb12 Rabbit Polyclonal Antibody (orb576266) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064349

Preservative

Lyophilized powder

AA Sequence

NQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-[(1S)-2,3-Dihydro-1H-inden-1-yl]-7H-pyrrolo[2,3-d]pyrimidin-4-amine
TRC-D449885-50MG 50 mg

N-[(1S)-2,3-Dihydro-1H-inden-1-yl]-7H-pyrrolo[2,3-d]pyrimidin-4-amine

Sign In for Pricing
View Details
SAE1 (NM_016402) Human Over-expression Lysate
LY429497 100 µg

SAE1 (NM_016402) Human Over-expression Lysate

Sign In for Pricing
View Details
POU6F1 (NM_002702) Human Recombinant Protein
TP308598M 100 µg

POU6F1 (NM_002702) Human Recombinant Protein

Sign In for Pricing
View Details
L-Glutaryl Carnitine-d9 Chloride
TRC-G597602-25MG 25 mg

L-Glutaryl Carnitine-d9 Chloride

Sign In for Pricing
View Details
Tmem80 Mouse Gene Knockout Kit (CRISPR)
KN517902 1 Kit

Tmem80 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS509925 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details