Dnajb12 Peptide - N-terminal region
Dnajb12 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Dj10, mDj10
UniProt
Q8K037
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Dnajb12 Rabbit Polyclonal Antibody (orb576266) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064349
Preservative
Lyophilized powder
AA Sequence
NQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![EPCAM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D5]](https://cdn.genprice.uk/products/937/6868c383994c49e6dc3f83a0/imageurl/ta506639bm.webp)
TA506639BM 100 µL
EPCAM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D5]
Sign In for Pricing
View Details 
BNC942265-500 1x 500 µL
BCL2-like 2 (CPTC-BCL2L2-2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Thyroid Hormone Receptor alpha (THRA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C12]](https://cdn.genprice.uk/products/937/68dd1b7c061270361ea1c830/imageurl/ta805259bm.webp)
TA805259BM 100 µL
Thyroid Hormone Receptor alpha (THRA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C12]
Sign In for Pricing
View Details 