Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJB4 Peptide - middle region

DNAJB4 Peptide - middle region

Product Specifications

Product Name Alternative

DNAJW, DjB4, HLJ1

UniProt

Q9UDY4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJB4 Rabbit Polyclonal Antibody (orb581646) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008965

Preservative

Lyophilized powder

AA Sequence

EGTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Potassium voltage-gated channel subfamily D member 2 (KCND2) ELISA Kit
MBS281408-01 48 Tests

Human Potassium voltage-gated channel subfamily D member 2 (KCND2) ELISA Kit

Sign In for Pricing
View Details
Human Potassium voltage-gated channel subfamily D member 2 (KCND2) ELISA Kit
MBS281408-02 96 Tests

Human Potassium voltage-gated channel subfamily D member 2 (KCND2) ELISA Kit

Sign In for Pricing
View Details
Human Potassium voltage-gated channel subfamily D member 2 (KCND2) ELISA Kit
MBS281408-03 5x 96 Tests

Human Potassium voltage-gated channel subfamily D member 2 (KCND2) ELISA Kit

Sign In for Pricing
View Details
Human Potassium voltage-gated channel subfamily D member 2 (KCND2) ELISA Kit
MBS281408-04 10x 96 Tests

Human Potassium voltage-gated channel subfamily D member 2 (KCND2) ELISA Kit

Sign In for Pricing
View Details
Anti-ATP2C1 Antibody
A03143-2 100 µL

Anti-ATP2C1 Antibody

Sign In for Pricing
View Details
CD239 Rabbit Polyclonal Antibody (RBITC)
orb1040554 100 µL

CD239 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details