Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC12 Peptide - middle region

DNAJC12 Peptide - middle region

Product Specifications

Product Name Alternative

JDP1, RP11-57G10.2

UniProt

Q9UKB3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC12 Rabbit Polyclonal Antibody (orb583613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068572

Preservative

Lyophilized powder

AA Sequence

EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyridine-d5
TRC-P991237-5G 5 g

Pyridine-d5

Sign In for Pricing
View Details
rac 1-Palmitoyl-2-oleoyl-3-chloropropanediol
TRC-P160500-10MG 10 mg

rac 1-Palmitoyl-2-oleoyl-3-chloropropanediol

Sign In for Pricing
View Details
MUC1 Antibody
8C10386-AAT 50 µg

MUC1 Antibody

Sign In for Pricing
View Details
BABAM1 Antibody
OC-288-01 50 μL

BABAM1 Antibody

Sign In for Pricing
View Details
BABAM1 Antibody
OC-288-02 100 µL

BABAM1 Antibody

Sign In for Pricing
View Details
BABAM1 Antibody
OC-288-03 1 mL

BABAM1 Antibody

Sign In for Pricing
View Details