Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC12 Peptide - middle region

DNAJC12 Peptide - middle region

Product Specifications

Product Name Alternative

JDP1, RP11-57G10.2

UniProt

Q9UKB3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC12 Rabbit Polyclonal Antibody (orb583613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068572

Preservative

Lyophilized powder

AA Sequence

EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Tendon
CS648981 5x 5 µm

Frozen Tissue Sections, Tendon

Sign In for Pricing
View Details
2-Naphthoic Acid
TRC-N345640-25G 25 g

2-Naphthoic Acid

Sign In for Pricing
View Details
Suberyl-CoA Sodium Salt
TRC-S689810-2.5MG 2.5 mg

Suberyl-CoA Sodium Salt

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013UG-01 25 µg

PE/Cyanine5 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013UG-02 100 µg

PE/Cyanine5 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
HES7 (N-term) Rabbit Polyclonal Antibody
AP52034PU-N 400 µL

HES7 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details