Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc17 Peptide - middle region

Dnajc17 Peptide - middle region

Product Specifications

Product Name Alternative

1700025B16Rik, C87112, D9Bwg1371e

UniProt

Q91WT4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajc17 Rabbit Polyclonal Antibody (orb576319) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631878

Preservative

Lyophilized powder

AA Sequence

RQDREQRLRGRTENTEGKGTPKLKLKWKCKKEDESQGGYSRDVLLRLLQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cathepsin E (CTSE) ELISA Kit
RDR-CTSE-Hu-01 96 Tests

Human Cathepsin E (CTSE) ELISA Kit

Sign In for Pricing
View Details
Human Cathepsin E (CTSE) ELISA Kit
RDR-CTSE-Hu-02 48 Tests

Human Cathepsin E (CTSE) ELISA Kit

Sign In for Pricing
View Details
Human NSUN2, N-Strep II, C-His Tag
HA210650-01 20 µg

Human NSUN2, N-Strep II, C-His Tag

Sign In for Pricing
View Details
Human NSUN2, N-Strep II, C-His Tag
HA210650-02 50 µg

Human NSUN2, N-Strep II, C-His Tag

Sign In for Pricing
View Details
Human NSUN2, N-Strep II, C-His Tag
HA210650-03 100 µg

Human NSUN2, N-Strep II, C-His Tag

Sign In for Pricing
View Details
USP40 Mouse Monoclonal Antibody [Clone ID: OTI1B1]
CF809854 100 µg

USP40 Mouse Monoclonal Antibody [Clone ID: OTI1B1]

Sign In for Pricing
View Details