Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc17 Peptide - middle region

Dnajc17 Peptide - middle region

Product Specifications

Product Name Alternative

1700025B16Rik, C87112, D9Bwg1371e

UniProt

Q91WT4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajc17 Rabbit Polyclonal Antibody (orb576319) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631878

Preservative

Lyophilized powder

AA Sequence

RQDREQRLRGRTENTEGKGTPKLKLKWKCKKEDESQGGYSRDVLLRLLQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6orf132 Human Gene Knockout Kit (CRISPR)
KN428651 1 Kit

C6orf132 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TMEM235 activation kit by CRISPRa
GA117080 1 Kit

Human TMEM235 activation kit by CRISPRa

Sign In for Pricing
View Details
APTS [8-Aminopyrene-1,3,6-trisulfonic acid, trisodium salt] *CAS 196504-57-1*
624-AAT 10 mg

APTS [8-Aminopyrene-1,3,6-trisulfonic acid, trisodium salt] *CAS 196504-57-1*

Sign In for Pricing
View Details
RTN1 Polyclonal Antibody
E-AB-66814-01 60 µL

RTN1 Polyclonal Antibody

Sign In for Pricing
View Details
RTN1 Polyclonal Antibody
E-AB-66814-02 120 µL

RTN1 Polyclonal Antibody

Sign In for Pricing
View Details
RTN1 Polyclonal Antibody
E-AB-66814-03 200 µL

RTN1 Polyclonal Antibody

Sign In for Pricing
View Details