Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC19 Peptide - C-terminal region

DNAJC19 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TIM14, TIMM14, PAM18

UniProt

Q96DA6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC19 Rabbit Polyclonal Antibody (orb584469) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660304

Preservative

Lyophilized powder

AA Sequence

LGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL15RA (NM_172200) Human Over-expression Lysate
LC403535 20 µg

IL15RA (NM_172200) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Mesencephalic astrocyte-derived neurotrophic factor ELISA Kit
MBS763964-01 48 Well

Rat Mesencephalic astrocyte-derived neurotrophic factor ELISA Kit

Sign In for Pricing
View Details
Rat Mesencephalic astrocyte-derived neurotrophic factor ELISA Kit
MBS763964-02 96 Well

Rat Mesencephalic astrocyte-derived neurotrophic factor ELISA Kit

Sign In for Pricing
View Details
Rat Mesencephalic astrocyte-derived neurotrophic factor ELISA Kit
MBS763964-03 5x 96 Well

Rat Mesencephalic astrocyte-derived neurotrophic factor ELISA Kit

Sign In for Pricing
View Details
Rat Mesencephalic astrocyte-derived neurotrophic factor ELISA Kit
MBS763964-04 10x 96 Well

Rat Mesencephalic astrocyte-derived neurotrophic factor ELISA Kit

Sign In for Pricing
View Details
Human DSEL Knockout HEK293T cell line
GTR15406770 1 Vial

Human DSEL Knockout HEK293T cell line

Sign In for Pricing
View Details