DNAJC19 Peptide - C-terminal region
DNAJC19 Peptide - C-terminal region
Product Specifications
Product Name Alternative
TIM14, TIMM14, PAM18
UniProt
Q96DA6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DNAJC19 Rabbit Polyclonal Antibody (orb584469) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_660304
Preservative
Lyophilized powder
AA Sequence
LGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1045078-01 0.02 mg (E-Coli)
Recombinant Delftia acidovorans Ribosome maturation factor RimP (rimP)
Sign In for Pricing
View Details 
MBS1045078-02 0.1 mg (E-Coli)
Recombinant Delftia acidovorans Ribosome maturation factor RimP (rimP)
Sign In for Pricing
View Details 
MBS1045078-03 0.02 mg (Yeast)
Recombinant Delftia acidovorans Ribosome maturation factor RimP (rimP)
Sign In for Pricing
View Details MBS1045078-04 0.1 mg (Yeast)
Recombinant Delftia acidovorans Ribosome maturation factor RimP (rimP)
Sign In for Pricing
View Details MBS1045078-05 0.02 mg (Baculovirus)
Recombinant Delftia acidovorans Ribosome maturation factor RimP (rimP)
Sign In for Pricing
View Details MBS1045078-06 0.02 mg (Mammalian-Cell)
Recombinant Delftia acidovorans Ribosome maturation factor RimP (rimP)
Sign In for Pricing
View Details