Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC2 Peptide - C-terminal region

DNAJC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MPHOSPH11, MPP11, ZRF1, ZUO1

UniProt

Q99543

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC2 Rabbit Polyclonal Antibody (orb584487) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055192

Preservative

Lyophilized powder

AA Sequence

EINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p53 (TP53) (NM_001126114) Human Over-expression Lysate
LY426654 100 µg

p53 (TP53) (NM_001126114) Human Over-expression Lysate

Sign In for Pricing
View Details
RHBDL1 (NM_001278721) Human Tagged ORF Clone
RG237287 10 µg

RHBDL1 (NM_001278721) Human Tagged ORF Clone

Sign In for Pricing
View Details
GUCY1B1 (189-207) Rabbit Polyclonal Antibody
AP22710PU-N 250 µL

GUCY1B1 (189-207) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TyraMaxTM 400/550 Amplification Dye, 100X
#96136-20UL 1x 20 µL

TyraMaxTM 400/550 Amplification Dye, 100X

Sign In for Pricing
View Details
Tissue FFPE Sections, Cartilage
CS807500 5x 5 µm

Tissue FFPE Sections, Cartilage

Sign In for Pricing
View Details