Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC2 Peptide - C-terminal region

DNAJC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MPHOSPH11, MPP11, ZRF1, ZUO1

UniProt

Q99543

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC2 Rabbit Polyclonal Antibody (orb584487) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055192

Preservative

Lyophilized powder

AA Sequence

EINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR114 Antibody
8G284-AAT 50 µg

GPR114 Antibody

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2670), CF594 conjugate, 0.1mg/mL
BNC942670-100 1x 100 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2670), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Syntaxin 16 (STX16) (NM_001001433) Human Over-expression Lysate
LC424352 20 µg

Syntaxin 16 (STX16) (NM_001001433) Human Over-expression Lysate

Sign In for Pricing
View Details
Hist1h2ail1 (pThr11) Mouse Monoclonal Antibody [Clone ID: N123/48]
75-224 100 µL

Hist1h2ail1 (pThr11) Mouse Monoclonal Antibody [Clone ID: N123/48]

Sign In for Pricing
View Details
Thymidine 5'-Diphosphate Trisodium Salt
TRC-T077195-250MG 250 mg

Thymidine 5'-Diphosphate Trisodium Salt

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1467), CF640R conjugate, 0.1mg/mL
BNC401467-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/1467), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details