Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc25 Peptide - middle region

Dnajc25 Peptide - middle region

Product Specifications

Product Name Alternative

2010109C08Rik, 2010203O07Rik, RP23-211P15.4

UniProt

A2ALW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajc25 Rabbit Polyclonal Antibody (orb579256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028337

Preservative

Lyophilized powder

AA Sequence

SYLATVPKYRIQATEIAKEQGLLKKAKEKGKNKKSKEEIRDEEENIIKNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYD88 (NM_001172567) Human Over-expression Lysate
LC432873 20 µg

MYD88 (NM_001172567) Human Over-expression Lysate

Sign In for Pricing
View Details
EMBERTM Ultra RNA Gel Kit (Trial Size)
#41044-T 1 Kit

EMBERTM Ultra RNA Gel Kit (Trial Size)

Sign In for Pricing
View Details
MOGAT2 Human Gene Knockout Kit (CRISPR)
KN418854 1 Kit

MOGAT2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Adam6b Mouse Gene Knockout Kit (CRISPR)
KN500843 1 Kit

Adam6b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EFHC2 (N-term) Rabbit Polyclonal Antibody
AP51377PU-N 400 µL

EFHC2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS639609 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details