Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc25 Peptide - middle region

Dnajc25 Peptide - middle region

Product Specifications

Product Name Alternative

2010109C08Rik, 2010203O07Rik, RP23-211P15.4

UniProt

A2ALW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajc25 Rabbit Polyclonal Antibody (orb579256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028337

Preservative

Lyophilized powder

AA Sequence

SYLATVPKYRIQATEIAKEQGLLKKAKEKGKNKKSKEEIRDEEENIIKNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS625384 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
3-Iodo-L-tyrosine
TRC-I728250-5G 5 g

3-Iodo-L-tyrosine

Sign In for Pricing
View Details
TREM2 Rabbit Polyclonal Antibody
ER2001-59 100 µL

TREM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zfp239 Mouse Gene Knockout Kit (CRISPR)
KN519757 1 Kit

Zfp239 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DNMT3A Rabbit Polyclonal Antibody
ER1902-62 100 µL

DNMT3A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PHLPP2 (N-term) Rabbit Polyclonal Antibody
AP14594PU-N 400 µL

PHLPP2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details