Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNASE1L3 Peptide - C-terminal region

DNASE1L3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DHP2, DNAS1L3, LSD, SLEB16

UniProt

Q13609

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNASE1L3 Rabbit Polyclonal Antibody (orb585093) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004935

Preservative

Lyophilized powder

AA Sequence

DFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRSN1 Antibody, FITC conjugated
CSB-PA815587LC01HU-01 50 µg

NRSN1 Antibody, FITC conjugated

Sign In for Pricing
View Details
NRSN1 Antibody, FITC conjugated
CSB-PA815587LC01HU-02 100 µg

NRSN1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Mouse Fibulin 3 (FBLN3) ELISA Kit
RDR-FBLN3-Mu-01 96 Tests

Mouse Fibulin 3 (FBLN3) ELISA Kit

Sign In for Pricing
View Details
Mouse Fibulin 3 (FBLN3) ELISA Kit
RDR-FBLN3-Mu-02 48 Tests

Mouse Fibulin 3 (FBLN3) ELISA Kit

Sign In for Pricing
View Details
ZBTB9 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
50730156 3x 1.0 µg DNA

ZBTB9 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal DNER Antibody
NBP1-88665 0.1 mL

Rabbit Polyclonal DNER Antibody

Sign In for Pricing
View Details