Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnmt1 Peptide - N-terminal region

Dnmt1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Cxxc9, Dnmt, Dnmt1o, MTase, Met-1, Met1, MommeD2, MCMT, m.MmuI

UniProt

P13864

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnmt1 Rabbit Polyclonal Antibody (orb576188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034196

Preservative

Lyophilized powder

AA Sequence

SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trim32 Mouse Gene Knockout Kit (CRISPR)
KN318203 1 Kit

Trim32 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Benzo[a]pyrene Diol Epoxide
TRC-B287550-25MG 25 mg

Benzo[a]pyrene Diol Epoxide

Sign In for Pricing
View Details
LRRC4B (N-term) Rabbit Polyclonal Antibody
AP52541PU-N 400 µL

LRRC4B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Thymus
CB502613 1 Block

Frozen Tissue Blocks, Thymus

Sign In for Pricing
View Details
Osteopontin (SPP1) (NM_001040058) Human Over-expression Lysate
LC421887 20 µg

Osteopontin (SPP1) (NM_001040058) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 20 Mouse Monoclonal Antibody [A3H7]
EM1901-97 100 µL

Cytokeratin 20 Mouse Monoclonal Antibody [A3H7]

Sign In for Pricing
View Details