Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOK4 Peptide - N-terminal region

DOK4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ10488

UniProt

Q8TEW6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DOK4 Rabbit Polyclonal Antibody (orb584620) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060580

Preservative

Lyophilized powder

AA Sequence

GPQRLEKYPDEKSVCLRGCPKVTEISNVKCVTRLPKETKRQAVAIIFTDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CNPase Antibody [Janelia Fluor 646]
NB110-79874JF646 0.1 mL

Rabbit Polyclonal CNPase Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
PPP1R7 Polyclonal Antibody
E913040 100 µL

PPP1R7 Polyclonal Antibody

Sign In for Pricing
View Details
PD1 Detection Set (Risk Free)
orb1227446 1 Each

PD1 Detection Set (Risk Free)

Sign In for Pricing
View Details
Recombinant Mouse Small conductance calcium-activated potassium channel protein 2 (Kcnn2), partial
orb2659217-01 20 µg

Recombinant Mouse Small conductance calcium-activated potassium channel protein 2 (Kcnn2), partial

Sign In for Pricing
View Details
Recombinant Mouse Small conductance calcium-activated potassium channel protein 2 (Kcnn2), partial
orb2659217-02 100 µg

Recombinant Mouse Small conductance calcium-activated potassium channel protein 2 (Kcnn2), partial

Sign In for Pricing
View Details
Recombinant Mouse Small conductance calcium-activated potassium channel protein 2 (Kcnn2), partial
orb2659217-03 1 mg

Recombinant Mouse Small conductance calcium-activated potassium channel protein 2 (Kcnn2), partial

Sign In for Pricing
View Details