Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOK6 Peptide - middle region

DOK6 Peptide - middle region

Product Specifications

Product Name Alternative

DOK5L, HsT3226, MGC20785

UniProt

Q6PKX4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DOK6 Rabbit Polyclonal Antibody (orb582784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689934

Preservative

Lyophilized powder

AA Sequence

IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myotrophin (D-3) FITC
sc-166072 FITC 200 µg/mL

Myotrophin (D-3) FITC

Sign In for Pricing
View Details
Recombinant Mouse TrkC Protein
ATGP3946-010 10 µg

Recombinant Mouse TrkC Protein

Sign In for Pricing
View Details
CNKSR2 Adenovirus (Human)
16462051 1.0 mL

CNKSR2 Adenovirus (Human)

Sign In for Pricing
View Details
TPCN2 Protein Vector (Mouse) (pPM-C-HA)
PV240872 500 ng

TPCN2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Bovine 3-nitrotyrosine (3-NT) ELISA Kit
OM620062 96 Strip Well

Bovine 3-nitrotyrosine (3-NT) ELISA Kit

Sign In for Pricing
View Details
Bovine Collagen alpha-1 (XII) chain (COL12A1) ELISA Kit
MBS7217145-01 48 Well

Bovine Collagen alpha-1 (XII) chain (COL12A1) ELISA Kit

Sign In for Pricing
View Details