Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPH1 Peptide - N-terminal region

DPH1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DPH2L, DPH2L1, FLJ33211, OVCA1

UniProt

Q9BZG8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DPH1 Rabbit Polyclonal Antibody (orb325708) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001374

Preservative

Lyophilized powder

AA Sequence

NQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQQAQAKKVALQMPEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 14 (CK-14, Dowling Meara, ebs3, ebs4, Epidermolysis Bullosa Simplex, k14, Keratin 14, Keratin Type I Cytoskeletal 14, Koebner, krt14, NFJ) (APC)
MBS6122999-01 0.1 mL

Cytokeratin 14 (CK-14, Dowling Meara, ebs3, ebs4, Epidermolysis Bullosa Simplex, k14, Keratin 14, Keratin Type I Cytoskeletal 14, Koebner, krt14, NFJ) (APC)

Sign In for Pricing
View Details
Cytokeratin 14 (CK-14, Dowling Meara, ebs3, ebs4, Epidermolysis Bullosa Simplex, k14, Keratin 14, Keratin Type I Cytoskeletal 14, Koebner, krt14, NFJ) (APC)
MBS6122999-02 5x 0.1 mL

Cytokeratin 14 (CK-14, Dowling Meara, ebs3, ebs4, Epidermolysis Bullosa Simplex, k14, Keratin 14, Keratin Type I Cytoskeletal 14, Koebner, krt14, NFJ) (APC)

Sign In for Pricing
View Details
TusD Antibody
orb834224 2 mg

TusD Antibody

Sign In for Pricing
View Details
ZKSCAN2 Antibody, FITC conjugated
A57848-100UG 100 µg

ZKSCAN2 Antibody, FITC conjugated

Sign In for Pricing
View Details
2,3-Dihydro-1H-isoindole-5-carbonitrile hydrochloride
JWB82351-01 100 mg

2,3-Dihydro-1H-isoindole-5-carbonitrile hydrochloride

Sign In for Pricing
View Details
2,3-Dihydro-1H-isoindole-5-carbonitrile hydrochloride
JWB82351-02 1 g

2,3-Dihydro-1H-isoindole-5-carbonitrile hydrochloride

Sign In for Pricing
View Details