Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPH1 Peptide - N-terminal region

DPH1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DPH2L, DPH2L1, FLJ33211, OVCA1

UniProt

Q9BZG8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DPH1 Rabbit Polyclonal Antibody (orb325708) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001374

Preservative

Lyophilized powder

AA Sequence

NQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQQAQAKKVALQMPEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-2-iodo-D-phenylalanine 99+% (HPLC)
235858-01 1 g

Boc-2-iodo-D-phenylalanine 99+% (HPLC)

Sign In for Pricing
View Details
Boc-2-iodo-D-phenylalanine 99+% (HPLC)
235858-02 5 g

Boc-2-iodo-D-phenylalanine 99+% (HPLC)

Sign In for Pricing
View Details
Human Myoglobin (MYO; MB) ELISA Kit
YP-W10731-01 48 Tests

Human Myoglobin (MYO; MB) ELISA Kit

Sign In for Pricing
View Details
Human Myoglobin (MYO; MB) ELISA Kit
YP-W10731-02 96 Tests

Human Myoglobin (MYO; MB) ELISA Kit

Sign In for Pricing
View Details
Aldob (NM_144903) Mouse Recombinant Protein
PM46926M5 20 µg

Aldob (NM_144903) Mouse Recombinant Protein

Sign In for Pricing
View Details
5-Bromo-3-methoxypyrazin-2-amine ≥95% (HPLC)
234000-01 100 mg

5-Bromo-3-methoxypyrazin-2-amine ≥95% (HPLC)

Sign In for Pricing
View Details