Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPPA4 Peptide - N-terminal region

DPPA4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2410091M23Rik, FLJ10713

UniProt

Q7L190

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DPPA4 Rabbit Polyclonal Antibody (orb583458) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060659

Preservative

Lyophilized powder

AA Sequence

MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant LAMP2 Antibody
RC-5778-01 50 μL

Recombinant LAMP2 Antibody

Sign In for Pricing
View Details
Recombinant LAMP2 Antibody
RC-5778-02 100 µL

Recombinant LAMP2 Antibody

Sign In for Pricing
View Details
Recombinant LAMP2 Antibody
RC-5778-03 1 mL

Recombinant LAMP2 Antibody

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF568 conjugate, 0.1mg/mL
BNC681555-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Di-tert-butylamine Hydrochloride
TRC-D749210-250MG 250 mg

Di-tert-butylamine Hydrochloride

Sign In for Pricing
View Details
HLA-DPB1 Polyclonal Antibody
E-AB-66192-01 60 µL

HLA-DPB1 Polyclonal Antibody

Sign In for Pricing
View Details