Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPPA4 Peptide - N-terminal region

DPPA4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2410091M23Rik, FLJ10713

UniProt

Q7L190

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DPPA4 Rabbit Polyclonal Antibody (orb583458) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060659

Preservative

Lyophilized powder

AA Sequence

MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Kidney
CR562641 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Uncoated Human LEPR (Leptin Receptor) ELISA Kit
E-UNEL-H0168-01 5x 96 Tests

Uncoated Human LEPR (Leptin Receptor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human LEPR (Leptin Receptor) ELISA Kit
E-UNEL-H0168-02 15x 96 Tests

Uncoated Human LEPR (Leptin Receptor) ELISA Kit

Sign In for Pricing
View Details
p53 (TP53) Rabbit Polyclonal Antibody
AP20989PU-N 100 µg

p53 (TP53) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
L189
TRC-L009020-5MG 5 mg

L189

Sign In for Pricing
View Details
Forced Convection Oven BOFC-5401
BOFC-5401 1 Unit

Forced Convection Oven BOFC-5401

Sign In for Pricing
View Details