Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dpy19l1 Peptide - C-terminal region

Dpy19l1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1100001I19Rik, 6030402K12, AI225861, AW558481

UniProt

A6X919

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dpy19l1 Rabbit Polyclonal Antibody (orb578861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766508

Preservative

Lyophilized powder

AA Sequence

VKLSALRPVVNHPHYEDAGLRARTKIVYSMYSRKAPEDVKKELMKLKVNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heat shock protein beta-6
AP78704-01 50 µg

Heat shock protein beta-6

Sign In for Pricing
View Details
Heat shock protein beta-6
AP78704-02 100 µg

Heat shock protein beta-6

Sign In for Pricing
View Details
Heat shock protein beta-6
AP78704-03 1 mg

Heat shock protein beta-6

Sign In for Pricing
View Details
TRIM29 Antibody
V7087-20UG 20 µg

TRIM29 Antibody

Sign In for Pricing
View Details
NEK4 Protein Vector (Rat) (pPB-C-His)
PV284894 500 ng

NEK4 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
PFKP Rabbit Monoclonal Antibody
E10G21836 100 µL

PFKP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details