Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dpy19l1 Peptide - C-terminal region

Dpy19l1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1100001I19Rik, 6030402K12, AI225861, AW558481

UniProt

A6X919

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dpy19l1 Rabbit Polyclonal Antibody (orb578861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766508

Preservative

Lyophilized powder

AA Sequence

VKLSALRPVVNHPHYEDAGLRARTKIVYSMYSRKAPEDVKKELMKLKVNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Somatostatin 28 Rabbit Polyclonal Antibody (BF680)
orb1573578 100 µL

Somatostatin 28 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
PIK3IP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
36684061 1.0 µg DNA

PIK3IP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Calcitonin, eel
M29727-01 100 mg

Calcitonin, eel

Sign In for Pricing
View Details
Calcitonin, eel
M29727-02 200 mg

Calcitonin, eel

Sign In for Pricing
View Details
Calcitonin, eel
M29727-03 500 mg

Calcitonin, eel

Sign In for Pricing
View Details
Calcitonin, eel
M29727-04 5 mg

Calcitonin, eel

Sign In for Pricing
View Details