Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dr1 Peptide - middle region

Dr1 Peptide - middle region

Product Specifications

Product Name Alternative

1700121L09Rik, Dr1l, NC2, NC2beta

UniProt

Q91WV0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dr1 Rabbit Polyclonal Antibody (orb573754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080382

Preservative

Lyophilized powder

AA Sequence

KKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Rat Phosphatidylinositol Binding Clathrin Assembly Protein (PICALM) ELISA
KLR5205 1x 96 Well

GENLISA Rat Phosphatidylinositol Binding Clathrin Assembly Protein (PICALM) ELISA

Sign In for Pricing
View Details
TRNAP5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV753229 1.0 µg DNA

TRNAP5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Monoclonal Acetoacetyl CoA synthetase Antibody (7H6F3E1) [Alexa Fluor 532]
NBP3-06615AF532 0.1 mL

Mouse Monoclonal Acetoacetyl CoA synthetase Antibody (7H6F3E1) [Alexa Fluor 532]

Sign In for Pricing
View Details
Mouse CTSR shRNA Plasmid
abx974919-01 150 µg

Mouse CTSR shRNA Plasmid

Sign In for Pricing
View Details
Mouse CTSR shRNA Plasmid
abx974919-02 300 µg

Mouse CTSR shRNA Plasmid

Sign In for Pricing
View Details
Mouse Phospholipase D1 ELISA Kit
MBS7256309-01 48 Well

Mouse Phospholipase D1 ELISA Kit

Sign In for Pricing
View Details