Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dr1 Peptide - middle region

Dr1 Peptide - middle region

Product Specifications

Product Name Alternative

1700121L09Rik, Dr1l, NC2, NC2beta

UniProt

Q91WV0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dr1 Rabbit Polyclonal Antibody (orb573754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080382

Preservative

Lyophilized powder

AA Sequence

KKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aquaporin, Adipose Specific (AQPAP, AQP7-Like)
MBS613903-01 0.1 mL

Aquaporin, Adipose Specific (AQPAP, AQP7-Like)

Sign In for Pricing
View Details
Aquaporin, Adipose Specific (AQPAP, AQP7-Like)
MBS613903-02 5x 0.1 mL

Aquaporin, Adipose Specific (AQPAP, AQP7-Like)

Sign In for Pricing
View Details
PNK1 (Phospho Ser114/Thr118) Antibody
A9605-01 50 μL

PNK1 (Phospho Ser114/Thr118) Antibody

Sign In for Pricing
View Details
PNK1 (Phospho Ser114/Thr118) Antibody
A9605-02 100 µL

PNK1 (Phospho Ser114/Thr118) Antibody

Sign In for Pricing
View Details
Rabbit Titin Antibody ELISA Kit
MBS022154 Inquire

Rabbit Titin Antibody ELISA Kit

Sign In for Pricing
View Details
Recombinant Daucus carota NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)
orb2919784-01 20 µg

Recombinant Daucus carota NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Sign In for Pricing
View Details