Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DSG3 Peptide - C-terminal region

DSG3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDHF6, DKFZp686P23184, PVA

UniProt

P32926

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DSG3 Rabbit Polyclonal Antibody (orb584956) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001935

Preservative

Lyophilized powder

AA Sequence

KKLAEISLGVDGEGKEVQPPSKDSGYGIESCGHPIEVQQTGFVKCQTLSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRIF1 Polyclonal Antibody
E-AB-52491-01 20 µL

LRIF1 Polyclonal Antibody

Sign In for Pricing
View Details
LRIF1 Polyclonal Antibody
E-AB-52491-02 60 µL

LRIF1 Polyclonal Antibody

Sign In for Pricing
View Details
LRIF1 Polyclonal Antibody
E-AB-52491-03 120 µL

LRIF1 Polyclonal Antibody

Sign In for Pricing
View Details
LRIF1 Polyclonal Antibody
E-AB-52491-04 200 µL

LRIF1 Polyclonal Antibody

Sign In for Pricing
View Details
Human Neugrin (NGRN) ELISA Kit
RDR-NGRN-Hu-01 96 Tests

Human Neugrin (NGRN) ELISA Kit

Sign In for Pricing
View Details
Human Neugrin (NGRN) ELISA Kit
RDR-NGRN-Hu-02 48 Tests

Human Neugrin (NGRN) ELISA Kit

Sign In for Pricing
View Details