Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DSG3 Peptide - C-terminal region

DSG3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDHF6, DKFZp686P23184, PVA

UniProt

P32926

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DSG3 Rabbit Polyclonal Antibody (orb584956) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001935

Preservative

Lyophilized powder

AA Sequence

KKLAEISLGVDGEGKEVQPPSKDSGYGIESCGHPIEVQQTGFVKCQTLSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DP Recombinant Rabbit Monoclonal Antibody [PD00-70]
HA721247 100 µL

HLA-DP Recombinant Rabbit Monoclonal Antibody [PD00-70]

Sign In for Pricing
View Details
SF3A3 Polyclonal Antibody
E-AB-40169-01 25 µL

SF3A3 Polyclonal Antibody

Sign In for Pricing
View Details
SF3A3 Polyclonal Antibody
E-AB-40169-02 100 µL

SF3A3 Polyclonal Antibody

Sign In for Pricing
View Details
3-Bromo-6-pyridinecarbonitrile
TRC-B686750-5G 5 g

3-Bromo-6-pyridinecarbonitrile

Sign In for Pricing
View Details
IL17B Human, His
OM296466-01 25 µg

IL17B Human, His

Sign In for Pricing
View Details
IL17B Human, His
OM296466-02 5 µg

IL17B Human, His

Sign In for Pricing
View Details