Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dtx3 Peptide - C-terminal region

Dtx3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Deltex3, MGC106339, mg310

UniProt

Q80V91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dtx3 Rabbit Polyclonal Antibody (orb330299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_109639

Preservative

Lyophilized powder

AA Sequence

YEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS545131 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Human AGER Active Recombinant Protein Lyophilized 100ug
IHUAGERARLY100UG 100 µg

Human AGER Active Recombinant Protein Lyophilized 100ug

Sign In for Pricing
View Details
TBC1D29 (NM_015594) Human Tagged ORF Clone
RC215489 10 µg

TBC1D29 (NM_015594) Human Tagged ORF Clone

Sign In for Pricing
View Details
ZNF805 Protein Vector (Human) (pPM-C-HA)
PV145700 500 ng

ZNF805 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TMEM232 shRNA Plasmid (m)
sc-143227-SH 20 µg

TMEM232 shRNA Plasmid (m)

Sign In for Pricing
View Details
ASPH Rabbit pAb
E45R26894N-50 50 µL

ASPH Rabbit pAb

Sign In for Pricing
View Details