Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dtx3 Peptide - C-terminal region

Dtx3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Deltex3, MGC106339, mg310

UniProt

Q80V91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dtx3 Rabbit Polyclonal Antibody (orb330299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_109639

Preservative

Lyophilized powder

AA Sequence

YEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rwdd2b siRNA Oligos set (Rat)
42904176 3x 5 nmol

Rwdd2b siRNA Oligos set (Rat)

Sign In for Pricing
View Details
(Mouse) Smad3 Rabbit Polyclonal Antibody
E10G33073 100 µL

(Mouse) Smad3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Donkey C-Terminal-Pro-Endothelin-1 (CT-PET-1) ELISA Kit
MBS9395839 Inquire

Donkey C-Terminal-Pro-Endothelin-1 (CT-PET-1) ELISA Kit

Sign In for Pricing
View Details
TCEB3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2348105 3x 1.0 µg

TCEB3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Cyclin D1 (CCND1) Mouse Monoclonal Antibody [Clone ID: LBI1G2]
AMM15165V 100 µL

Cyclin D1 (CCND1) Mouse Monoclonal Antibody [Clone ID: LBI1G2]

Sign In for Pricing
View Details
Anti-BMP4 Rabbit Monoclonal Antibody
MA1489-.1 100 µL

Anti-BMP4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details