Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUS1L Peptide - middle region

DUS1L Peptide - middle region

Product Specifications

Product Name Alternative

DUS1, PP3111

UniProt

Q6P1R4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUS1L Rabbit Polyclonal Antibody (orb583635) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071439

Preservative

Lyophilized powder

AA Sequence

KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl-3-acetoxy-5-phenylpyrrole
TRC-A168030-25MG 25 mg

N-Acetyl-3-acetoxy-5-phenylpyrrole

Sign In for Pricing
View Details
Recombinant Cripto 1 Antibody
RC-16014-01 50 μL

Recombinant Cripto 1 Antibody

Sign In for Pricing
View Details
Recombinant Cripto 1 Antibody
RC-16014-02 100 µL

Recombinant Cripto 1 Antibody

Sign In for Pricing
View Details
Recombinant Cripto 1 Antibody
RC-16014-03 1 mL

Recombinant Cripto 1 Antibody

Sign In for Pricing
View Details
Decladinose Roxithromycin (Roxithromycin Impurity B)
TRC-D226800-25MG 25 mg

Decladinose Roxithromycin (Roxithromycin Impurity B)

Sign In for Pricing
View Details
c-Myb (MYB) (NM_001161657) Human Over-expression Lysate
LC431477 20 µg

c-Myb (MYB) (NM_001161657) Human Over-expression Lysate

Sign In for Pricing
View Details