Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUS1L Peptide - middle region

DUS1L Peptide - middle region

Product Specifications

Product Name Alternative

DUS1, PP3111

UniProt

Q6P1R4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUS1L Rabbit Polyclonal Antibody (orb583635) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071439

Preservative

Lyophilized powder

AA Sequence

KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 Human Gene Knockout Kit (CRISPR)
KN201850LP 1 Kit

AKT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS704084 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
CYB5D1 Polyclonal Antibody
E-AB-17876-01 20 µL

CYB5D1 Polyclonal Antibody

Sign In for Pricing
View Details
CYB5D1 Polyclonal Antibody
E-AB-17876-02 60 µL

CYB5D1 Polyclonal Antibody

Sign In for Pricing
View Details
CYB5D1 Polyclonal Antibody
E-AB-17876-03 120 µL

CYB5D1 Polyclonal Antibody

Sign In for Pricing
View Details
CYB5D1 Polyclonal Antibody
E-AB-17876-04 200 µL

CYB5D1 Polyclonal Antibody

Sign In for Pricing
View Details