Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dusp11 Peptide - N-terminal region

Dusp11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2010300F21Rik, AI481497

UniProt

Q6NXK5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dusp11 Rabbit Polyclonal Antibody (orb577607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082375

Preservative

Lyophilized powder

AA Sequence

GQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIN28 (LIN28A, CSDD1, LIN28, ZCCHC1, Protein Lin-28 Homolog A, Lin-28A, Zinc Finger CCHC Domain-containing Protein 1, FLJ12457, LIN-28) (APC)
129107-APC 100 µL

LIN28 (LIN28A, CSDD1, LIN28, ZCCHC1, Protein Lin-28 Homolog A, Lin-28A, Zinc Finger CCHC Domain-containing Protein 1, FLJ12457, LIN-28) (APC)

Sign In for Pricing
View Details
Constitutive androstane receptor Rabbit Polyclonal Antibody (Cy5)
orb939293 100 µL

Constitutive androstane receptor Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Gm2897 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3643808 1.0 µg DNA

Gm2897 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Olr754 Protein Vector (Rat) (pPB-N-His)
PV291039 500 ng

Olr754 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Toll Like Receptor 4 (TLR4) ELISA Kit
orb2812142-01 48 Tests

Mouse Toll Like Receptor 4 (TLR4) ELISA Kit

Sign In for Pricing
View Details
Mouse Toll Like Receptor 4 (TLR4) ELISA Kit
orb2812142-02 96 Tests

Mouse Toll Like Receptor 4 (TLR4) ELISA Kit

Sign In for Pricing
View Details