Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dusp11 Peptide - N-terminal region

Dusp11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2010300F21Rik, AI481497

UniProt

Q6NXK5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dusp11 Rabbit Polyclonal Antibody (orb577607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082375

Preservative

Lyophilized powder

AA Sequence

GQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human OGFOD3 shRNA (UAS) - Lentiviral human OGFOD3 shRNA (UAS) (25)
GTR15328580 1 Vial

Lentiviral human OGFOD3 shRNA (UAS) - Lentiviral human OGFOD3 shRNA (UAS) (25)

Sign In for Pricing
View Details
GATD3B Polyclonal Antibody
MBS2562402-01 0.02 mL

GATD3B Polyclonal Antibody

Sign In for Pricing
View Details
GATD3B Polyclonal Antibody
MBS2562402-02 0.06 mL

GATD3B Polyclonal Antibody

Sign In for Pricing
View Details
GATD3B Polyclonal Antibody
MBS2562402-03 0.12 mL

GATD3B Polyclonal Antibody

Sign In for Pricing
View Details
GATD3B Polyclonal Antibody
MBS2562402-04 0.2 mL

GATD3B Polyclonal Antibody

Sign In for Pricing
View Details
GATD3B Polyclonal Antibody
MBS2562402-05 5x 0.2 mL

GATD3B Polyclonal Antibody

Sign In for Pricing
View Details