Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dusp19 Peptide - N-terminal region

Dusp19 Peptide - N-terminal region

Product Specifications

UniProt

D4A8F3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dusp19 Rabbit Polyclonal Antibody (orb581738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101209

Preservative

Lyophilized powder

AA Sequence

MHSLNQEIKAFSRDNLRKQCTRVTTLTGKKLIETWKDATVHVVETETSGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hyaluronidase-2 HYAL2 Antibody Picoband® Fluoro647 Conjugated
PA1817-Fluoro647 100 µg/Vial

Anti-Hyaluronidase-2 HYAL2 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Ifenprodil glucuronide
HY-111587-01 5 mg

Ifenprodil glucuronide

Sign In for Pricing
View Details
Ifenprodil glucuronide
HY-111587-02 25 mg

Ifenprodil glucuronide

Sign In for Pricing
View Details
Ifenprodil glucuronide
HY-111587-03 50 mg

Ifenprodil glucuronide

Sign In for Pricing
View Details
Rabbit Polyclonal RIPK3/RIP3 Antibody [Alexa Fluor 750]
NBP1-77299AF750 0.1 mL

Rabbit Polyclonal RIPK3/RIP3 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
DNAH5 Antibody, HRP conjugated
CSB-PA819476LB01HU-01 50 µg

DNAH5 Antibody, HRP conjugated

Sign In for Pricing
View Details