Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP5 Peptide - middle region

DUSP5 Peptide - middle region

Product Specifications

Product Name Alternative

DUSP, HVH3

UniProt

Q16690

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUSP5 Rabbit Polyclonal Antibody (orb583922) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004410

Preservative

Lyophilized powder

AA Sequence

AGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP (Substance P) BioAssayTM ELISA Kit (Human) discontinued
370233-01 48 Tests

SP (Substance P) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
SP (Substance P) BioAssayTM ELISA Kit (Human) discontinued
370233-02 96 Tests

SP (Substance P) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Mouse Lysyl tRNA Synthetase (KARS) ELISA Kit
MBS2023685-01 24 Strip Well

Mouse Lysyl tRNA Synthetase (KARS) ELISA Kit

Sign In for Pricing
View Details
Mouse Lysyl tRNA Synthetase (KARS) ELISA Kit
MBS2023685-02 48 Well

Mouse Lysyl tRNA Synthetase (KARS) ELISA Kit

Sign In for Pricing
View Details
Mouse Lysyl tRNA Synthetase (KARS) ELISA Kit
MBS2023685-03 96 Well

Mouse Lysyl tRNA Synthetase (KARS) ELISA Kit

Sign In for Pricing
View Details
Mouse Lysyl tRNA Synthetase (KARS) ELISA Kit
MBS2023685-04 5x 96 Well

Mouse Lysyl tRNA Synthetase (KARS) ELISA Kit

Sign In for Pricing
View Details