Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP5 Peptide - middle region

DUSP5 Peptide - middle region

Product Specifications

Product Name Alternative

DUSP, HVH3

UniProt

Q16690

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUSP5 Rabbit Polyclonal Antibody (orb583923) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004410

Preservative

Lyophilized powder

AA Sequence

ANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam57b ORF Vector (Mouse) (pORF)
ORF044496 1.0 µg DNA

Fam57b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
1-benzyl-4- (2-nitrobenzoyl) piperazine
FFA56449 250 mg

1-benzyl-4- (2-nitrobenzoyl) piperazine

Sign In for Pricing
View Details
BANF2 siRNA (Human)
CRJ5331-01 15 nmol

BANF2 siRNA (Human)

Sign In for Pricing
View Details
BANF2 siRNA (Human)
CRJ5331-02 30 nmol

BANF2 siRNA (Human)

Sign In for Pricing
View Details
Anti-IL12B Antibody Picoband® (Cy3 Conjugate)
A01152-3-Cy3 100 µg/Vial

Anti-IL12B Antibody Picoband® (Cy3 Conjugate)

Sign In for Pricing
View Details
Recombinant Discs, Large Homolog Associated Protein 5 (DLGAP5)
TRV-0006550-01 10 µg

Recombinant Discs, Large Homolog Associated Protein 5 (DLGAP5)

Sign In for Pricing
View Details