Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC1I2 Peptide - N-terminal region

DYNC1I2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DNCI2, FLJ21089, FLJ90842, IC2, MGC104199, MGC111094, MGC9324

UniProt

Q13409

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYNC1I2 Rabbit Polyclonal Antibody (orb330651) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001369

Preservative

Lyophilized powder

AA Sequence

VAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAD10 Rabbit Polyclonal Antibody (FITC)
orb2096886 100 µL

ACAD10 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) Antibody
orb1713008 0.1 mL

IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) Antibody

Sign In for Pricing
View Details
Antiallergic agent-1
orb1686212-01 25 mg

Antiallergic agent-1

Sign In for Pricing
View Details
Antiallergic agent-1
orb1686212-02 50 mg

Antiallergic agent-1

Sign In for Pricing
View Details
Antiallergic agent-1
orb1686212-03 100 mg

Antiallergic agent-1

Sign In for Pricing
View Details
Lentiviral human FKBP7 shRNA (UAS) - Lentiviral human FKBP7 shRNA (UAS, iRFP) (25)
GTR15118586 1 Vial

Lentiviral human FKBP7 shRNA (UAS) - Lentiviral human FKBP7 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details