Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC1I2 Peptide - N-terminal region

DYNC1I2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DNCI2, FLJ21089, FLJ90842, IC2, MGC104199, MGC111094, MGC9324

UniProt

Q13409

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYNC1I2 Rabbit Polyclonal Antibody (orb330651) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001369

Preservative

Lyophilized powder

AA Sequence

VAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Prostate-Specific Antigen Isoform [-2]proPSA (P2PSA) ELISA Kit
MBS9394789-01 48 Well

Mouse Prostate-Specific Antigen Isoform [-2]proPSA (P2PSA) ELISA Kit

Sign In for Pricing
View Details
Mouse Prostate-Specific Antigen Isoform [-2]proPSA (P2PSA) ELISA Kit
MBS9394789-02 96 Well

Mouse Prostate-Specific Antigen Isoform [-2]proPSA (P2PSA) ELISA Kit

Sign In for Pricing
View Details
Mouse Prostate-Specific Antigen Isoform [-2]proPSA (P2PSA) ELISA Kit
MBS9394789-03 5x 96 Well

Mouse Prostate-Specific Antigen Isoform [-2]proPSA (P2PSA) ELISA Kit

Sign In for Pricing
View Details
Mouse Prostate-Specific Antigen Isoform [-2]proPSA (P2PSA) ELISA Kit
MBS9394789-04 10x 96 Well

Mouse Prostate-Specific Antigen Isoform [-2]proPSA (P2PSA) ELISA Kit

Sign In for Pricing
View Details
Human Hepatocellular Carcinoma Cell [SNU423]
AFG-ELL-3263 > 1x 10^6 Cells / Vial

Human Hepatocellular Carcinoma Cell [SNU423]

Sign In for Pricing
View Details
QPP-I-6
orb2565398-01 50 mg

QPP-I-6

Sign In for Pricing
View Details