Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dyrk1a Peptide - N-terminal region

Dyrk1a Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310043O08Rik, D16Ertd272e, D16Ertd493e, Dyrk, ENSMUSG00000074897, Gm10783, MGC150253, MGC150254, Mnbh, Mp86, mmb

UniProt

Q63470

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dyrk1a Rabbit Polyclonal Antibody (orb579577) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031916

Preservative

Lyophilized powder

AA Sequence

SFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal CD24 Antibody (91) [FITC]
NBP1-27913 0.25 mg

Rat Monoclonal CD24 Antibody (91) [FITC]

Sign In for Pricing
View Details
Mouse SLC35F3 siRNA
abx933914-01 15 nmol

Mouse SLC35F3 siRNA

Sign In for Pricing
View Details
Mouse SLC35F3 siRNA
abx933914-02 30 nmol

Mouse SLC35F3 siRNA

Sign In for Pricing
View Details
Rabbit Polyclonal OBFC1 Antibody [Alexa Fluor 488]
NBP2-99011AF488 0.1 mL

Rabbit Polyclonal OBFC1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Rabbit Polyclonal Mago nashi homolog 2 Antibody
NBP2-84154-0.1mL 0.1 mL

Rabbit Polyclonal Mago nashi homolog 2 Antibody

Sign In for Pricing
View Details
Preservation Buffer SD
MDBU00670100 100 mL

Preservation Buffer SD

Sign In for Pricing
View Details