Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dyrk1a Peptide - N-terminal region

Dyrk1a Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310043O08Rik, D16Ertd272e, D16Ertd493e, Dyrk, ENSMUSG00000074897, Gm10783, MGC150253, MGC150254, Mnbh, Mp86, mmb

UniProt

Q63470

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dyrk1a Rabbit Polyclonal Antibody (orb579577) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031916

Preservative

Lyophilized powder

AA Sequence

SFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTMP 100mM Sodium Solution
dNMP004-1 1 mL

DTMP 100mM Sodium Solution

Sign In for Pricing
View Details
Diphenidol HCl 500mg
A14244-500 500 mg

Diphenidol HCl 500mg

Sign In for Pricing
View Details
NFKB1 Antibody
F47079-0.08ML 0.08 mL

NFKB1 Antibody

Sign In for Pricing
View Details
Anti-Hexokinase 1/HK1 Antibody Picoband® (monoclonal, 4B7) Fluoro594 Conjugated
M01504-2-Fluoro594 100 µg/Vial

Anti-Hexokinase 1/HK1 Antibody Picoband® (monoclonal, 4B7) Fluoro594 Conjugated

Sign In for Pricing
View Details
TF-1
CSC-C0395 One Frozen Vial

TF-1

Sign In for Pricing
View Details
Pxk Mouse shRNA Plasmid (Locus ID 218699)
TL506582 1 Kit

Pxk Mouse shRNA Plasmid (Locus ID 218699)

Sign In for Pricing
View Details