Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYRK3 Peptide - N-terminal region

DYRK3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DYRK5, RED, REDK, hYAK3-2

UniProt

O43781

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYRK3 Rabbit Polyclonal Antibody (orb573667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IF, WB

NCBI Accession Number

NP_003573

Preservative

Lyophilized powder

AA Sequence

GDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Nms shRNA (UAS) - Lentiviral mouse Nms shRNA (UAS, iRFP) (100)
GTR15216183 1 Vial

Lentiviral mouse Nms shRNA (UAS) - Lentiviral mouse Nms shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to B-Lymphoid Tyrosine Kinase (BLK)
MBS2074311-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to B-Lymphoid Tyrosine Kinase (BLK)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to B-Lymphoid Tyrosine Kinase (BLK)
MBS2074311-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to B-Lymphoid Tyrosine Kinase (BLK)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to B-Lymphoid Tyrosine Kinase (BLK)
MBS2074311-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to B-Lymphoid Tyrosine Kinase (BLK)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to B-Lymphoid Tyrosine Kinase (BLK)
MBS2074311-04 1 mL

APC/CY7-Linked Polyclonal Antibody to B-Lymphoid Tyrosine Kinase (BLK)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to B-Lymphoid Tyrosine Kinase (BLK)
MBS2074311-05 5 mL

APC/CY7-Linked Polyclonal Antibody to B-Lymphoid Tyrosine Kinase (BLK)

Sign In for Pricing
View Details