Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ebf3 Peptide - N-terminal region

Ebf3 Peptide - N-terminal region

Product Specifications

UniProt

D4A274

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ebf3 Rabbit Polyclonal Antibody (orb329665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101976

Preservative

Lyophilized powder

AA Sequence

MNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC63 AAV Vector (Mouse) (CMV)
27692104 1 µg

LRRC63 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
H-Gln-bNA · HCl
K-1245.0250 250.0mg

H-Gln-bNA · HCl

Sign In for Pricing
View Details
TAAL6 Rabbit Polyclonal Antibody (Biotin)
orb458742 100 µL

TAAL6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
PLA (5K) -PEG-SC, 5K
HE064023-5K Inquire

PLA (5K) -PEG-SC, 5K

Sign In for Pricing
View Details
ANKRD28 Knockout huh-7 Polyclonal Cells
ARG27897 1 Million

ANKRD28 Knockout huh-7 Polyclonal Cells

Sign In for Pricing
View Details
Human Tsukushin (TSKU) ELISA Kit
abx555498 96 Tests

Human Tsukushin (TSKU) ELISA Kit

Sign In for Pricing
View Details