Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ebf4 Peptide - middle region

Ebf4 Peptide - middle region

Product Specifications

Product Name Alternative

Ebf3, O/E-4, Olf-1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ebf4 Rabbit Polyclonal Antibody (orb576327) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694538

Preservative

Lyophilized powder

AA Sequence

ARSCGSASPRFAPSPGSQQSSYGSGLGAGLGSYGAPGVTGLGVPGSPSFL

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHB2 Antibody
MBS8527239-01 0.1 mg

PHB2 Antibody

Sign In for Pricing
View Details
PHB2 Antibody
MBS8527239-02 0.1 mL (AF405L)

PHB2 Antibody

Sign In for Pricing
View Details
PHB2 Antibody
MBS8527239-03 0.1 mL (AF405S)

PHB2 Antibody

Sign In for Pricing
View Details
PHB2 Antibody
MBS8527239-04 0.1 mL (AF610)

PHB2 Antibody

Sign In for Pricing
View Details
PHB2 Antibody
MBS8527239-05 0.1 mL (AF635)

PHB2 Antibody

Sign In for Pricing
View Details
PHB2 Antibody
MBS8527239-06 0.1 mL (APC)

PHB2 Antibody

Sign In for Pricing
View Details