Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBI3 Peptide - middle region

EBI3 Peptide - middle region

Product Specifications

Product Name Alternative

IL27B, IL-27B

UniProt

Q14213

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EBI3 Rabbit Polyclonal Antibody (orb330229) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005746

Preservative

Lyophilized powder

AA Sequence

TAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-6 (B cell differentiation factor, B Cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Cytotoxic T cell differentiation factor, Hepatocyte stimulating factor, HPGF, HSF, Hybridoma growth factor (HGF), Hybridoma growth factor Interferon beta-2, Hybridoma plasmacytoma growth factor, IFN-beta-2, IFNB2, Interferon beta-2, Interleukin 6 (interferon beta 2) )
168807-01 20 µg

IL-6 (B cell differentiation factor, B Cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Cytotoxic T cell differentiation factor, Hepatocyte stimulating factor, HPGF, HSF, Hybridoma growth factor (HGF), Hybridoma growth factor Interferon beta-2, Hybridoma plasmacytoma growth factor, IFN-beta-2, IFNB2, Interferon beta-2, Interleukin 6 (interferon beta 2) )

Sign In for Pricing
View Details
IL-6 (B cell differentiation factor, B Cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Cytotoxic T cell differentiation factor, Hepatocyte stimulating factor, HPGF, HSF, Hybridoma growth factor (HGF), Hybridoma growth factor Interferon beta-2, Hybridoma plasmacytoma growth factor, IFN-beta-2, IFNB2, Interferon beta-2, Interleukin 6 (interferon beta 2) )
168807-02 100 µg

IL-6 (B cell differentiation factor, B Cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Cytotoxic T cell differentiation factor, Hepatocyte stimulating factor, HPGF, HSF, Hybridoma growth factor (HGF), Hybridoma growth factor Interferon beta-2, Hybridoma plasmacytoma growth factor, IFN-beta-2, IFNB2, Interferon beta-2, Interleukin 6 (interferon beta 2) )

Sign In for Pricing
View Details
BI-1347
S1058-5mg 5 mg

BI-1347

Sign In for Pricing
View Details
Lentiviral mouse Adora2b shRNA (UAS) - Lentiviral mouse Adora2b shRNA (UAS, RFP) (25)
GTR15277631 1 Vial

Lentiviral mouse Adora2b shRNA (UAS) - Lentiviral mouse Adora2b shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
mmu-miR-297c-3p miRNA Mimic
MBS8301137-01 5 nmol

mmu-miR-297c-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-297c-3p miRNA Mimic
MBS8301137-02 10 nmol

mmu-miR-297c-3p miRNA Mimic

Sign In for Pricing
View Details