Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBI3 Peptide - middle region

EBI3 Peptide - middle region

Product Specifications

Product Name Alternative

IL27B, IL-27B

UniProt

Q14213

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EBI3 Rabbit Polyclonal Antibody (orb330229) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005746

Preservative

Lyophilized powder

AA Sequence

TAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Protein FAM83A (FAM83A)
MBS1473538-01 0.02 mg (E-Coli)

Recombinant Human Protein FAM83A (FAM83A)

Sign In for Pricing
View Details
Recombinant Human Protein FAM83A (FAM83A)
MBS1473538-02 0.02 mg (Yeast)

Recombinant Human Protein FAM83A (FAM83A)

Sign In for Pricing
View Details
Recombinant Human Protein FAM83A (FAM83A)
MBS1473538-03 0.1 mg (E-Coli)

Recombinant Human Protein FAM83A (FAM83A)

Sign In for Pricing
View Details
Recombinant Human Protein FAM83A (FAM83A)
MBS1473538-04 0.1 mg (Yeast)

Recombinant Human Protein FAM83A (FAM83A)

Sign In for Pricing
View Details
Recombinant Human Protein FAM83A (FAM83A)
MBS1473538-05 0.02 mg (Baculovirus)

Recombinant Human Protein FAM83A (FAM83A)

Sign In for Pricing
View Details
Recombinant Human Protein FAM83A (FAM83A)
MBS1473538-06 0.02 mg (Mammalian-Cell)

Recombinant Human Protein FAM83A (FAM83A)

Sign In for Pricing
View Details