Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDIL3 Peptide - N-terminal region

EDIL3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DEL1, MGC26287

UniProt

O43854

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EDIL3 Rabbit Polyclonal Antibody (orb581566) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005702

Preservative

Lyophilized powder

AA Sequence

EPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GnRH-Receptor / LH-RH Receptor (GNRHR/2982R), CF647 conjugate, 0.1mg/mL
BNC472982-500 1x 500 µL

GnRH-Receptor / LH-RH Receptor (GNRHR/2982R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DDIT3 Recombinant Rabbit monoclonal Antibody
HA750369 100 µL

DDIT3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
BPIFB3 Polyclonal Antibody
E-AB-12543-01 20 µL

BPIFB3 Polyclonal Antibody

Sign In for Pricing
View Details
BPIFB3 Polyclonal Antibody
E-AB-12543-02 60 µL

BPIFB3 Polyclonal Antibody

Sign In for Pricing
View Details
BPIFB3 Polyclonal Antibody
E-AB-12543-03 120 µL

BPIFB3 Polyclonal Antibody

Sign In for Pricing
View Details
BPIFB3 Polyclonal Antibody
E-AB-12543-04 200 µL

BPIFB3 Polyclonal Antibody

Sign In for Pricing
View Details